PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA07G06830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 357aa    MW: 35934.3 Da    PI: 9.7554
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA07G06830.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.13.9e-3873131260
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                      +e  lkcprCdstntkfCy+nnysl+qPr+fCkaCrryWt+GGalrnvPvGgg r+nk+
  ONIVA07G06830.1  73 PEPGLKCPRCDSTNTKFCYFNNYSLTQPRHFCKACRRYWTRGGALRNVPVGGGFRRNKR 131
                      56789****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3663131IPR003851Zinc finger, Dof-type
PfamPF027013.2E-3277131IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.34877131IPR003851Zinc finger, Dof-type
PROSITE patternPS01361079115IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MWNQHQAHHG HHQLHQSVEA NQLPMTSVSL LLAPRSPDMA AAGILPVSGG GGASSARPAS  60
MAERARMAKI PQPEPGLKCP RCDSTNTKFC YFNNYSLTQP RHFCKACRRY WTRGGALRNV  120
PVGGGFRRNK RGTKPSNSKK PAAAVAGGVM APPHAQLQLP FGFDGGGGGG GHGSIIGGGG  180
GGGASRLGFP ELSSLHAAAA VDYQLGGGGG GDGLGLERQR LPHFPFLARS NAAVHPLPLM  240
STAAGISYPF GDVAAGGLGG DMPANAASVA GSAGLITQMA SVKMDDIDNH PPPSAATTTA  300
SSPIEFLGLR GSLQFWGGGG GHRDGGDGAG GSAAPGGGGG GWSDLPAFDL STSGNIL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0685420.0AK068542.1 Oryza sativa Japonica Group cDNA clone:J013155H18, full insert sequence.
GenBankAP0043030.0AP004303.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0407H12.
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645541.10.0PREDICTED: dof zinc finger protein DOF5.1 isoform X3
TrEMBLA0A0E0HYG50.0A0A0E0HYG5_ORYNI; Uncharacterized protein
STRINGBGIOSGA040507-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48932961
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.18e-42OBF-binding protein 3